PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G096700.1
Common NameB456_001G096700, LOC105789991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 567aa    MW: 62247.6 Da    PI: 6.0692
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G096700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.98e-27194247155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G ++AtPk+ilelm+v+ Lt ++v SHLQk+Rl
  Gorai.001G096700.1 194 KPRIVWSAELHSKFVAAVNQL-GMKNATPKKILELMNVEKLTTQNVGSHLQKFRL 247
                         79*******************.9*******************************8 PP

2Response_reg81.52.7e-27201261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                         vl vdD+p+ + ll+++l++ +y +v+++ ++  al+ll+++++Dl+++D+ mp+mdG++ll+     e++lp+i+++a+g+ + + + + 
  Gorai.001G096700.1  20 VLAVDDDPTCLLLLETLLRRCKY-NVTTTNQAITALKLLRQNKFDLVICDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTNVVMKGIT 108
                         799********************.**************************************87754.558******************** PP

                         TTESEEEESS--HHHHHH CS
        Response_reg  92 aGakdflsKpfdpeelvk 109
                          Ga d+l Kp+ +eel +
  Gorai.001G096700.1 109 HGACDYLLKPVRIEELNN 126
                         **************9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.2E-4217158No hitNo description
SuperFamilySSF521721.71E-3718144IPR011006CheY-like superfamily
SMARTSM004484.3E-3118128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.54119132IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.3E-2520126IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.65E-2521124No hitNo description
PROSITE profilePS5129410.587188250IPR017930Myb domain
SuperFamilySSF466894.3E-18192251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-27193252IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-22194247IPR006447Myb domain, plants
PfamPF002493.1E-6198245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MRVERIINET NDEFPIGIRV LAVDDDPTCL LLLETLLRRC KYNVTTTNQA ITALKLLRQN  60
KFDLVICDVH MPDMDGFKLL ELVGLEMDLP VIMLSANGDT NVVMKGITHG ACDYLLKPVR  120
IEELNNIWQH VVRRKRFERK DRYNSDSQDK LRADSGEAVG MGSIGNNGKL KKKRKDQDED  180
EERDENEDPS IRKKPRIVWS AELHSKFVAA VNQLGMKNAT PKKILELMNV EKLTTQNVGS  240
HLQKFRLYLK RISCAANQQV NIAAAVRMRS PNGLGNFHTL AGSNQLHNAA FRSFPPRGVL  300
GRLNTHAGLL IRSLPSPGTI RSGHGQSAVN SGNDQSKLQS FVSGIHNANI LQGLPMSLEL  360
DQVQTNNGVS HIGELPIADS TTVFPVSSSL IDATITGFSG NPLLGVTSHS LMLEASSQQA  420
GNSRDIVPAI GFRNGNTLSD FAPLAPASNR ESNADLQCEP IPINCNAGEL ITSAPQEWNS  480
PYQSNVTPCS MNSSIPVSGT MVQFGLCLDQ NNSMDSDSIG PSSFIDNSAM EQSIIDKEGY  540
LMLEPWEQGS HIPYNIGLLE DLWELQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22190253164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472811.10.0PREDICTED: two-component response regulator ARR12-like isoform X1
SwissprotP625981e-131ARR12_ARATH; Two-component response regulator ARR12
TrEMBLA0A0D2LWT80.0A0A0D2LWT8_G
STRINGPOPTR_0006s27800.11e-169(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2505534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-111response regulator 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]